ExPSIBLAST: Difference between revisions
| (17 intermediate revisions by 2 users not shown) | |||
| Line 3: | Line 3: | ||
==Introduction== | ==Introduction== | ||
Earlier in the course you have used the BLAST program to perform fast alignments of DNA and protein sequences. As shown in today's lecture, BLAST will often fail to recognize relationships between proteins with low sequence similarity. In today's exercise, you will use the iterative BLAST program (PSI-BLAST) to calculate sequence profiles and see how such profiles can be used to | Earlier in the course you have used the BLAST program to perform fast alignments of DNA and protein sequences. As shown in today's lecture, BLAST will often fail to recognize relationships between proteins with low sequence similarity. In today's exercise, you will use the iterative BLAST program (PSI-BLAST) to calculate sequence profiles and see how such profiles can be used to identify relationships between proteins with low sequence similarity. | ||
<!-- * Identify conserved residues in protein sequences (residues important for the structural stability or function of the protein) --> | |||
* Identify conserved residues in protein sequences (residues important for the structural stability or function of the protein) | |||
===Links=== | ===Links=== | ||
| Line 11: | Line 10: | ||
<!-- * [https://services.healthtech.dtu.dk/service.php?Blast2logo Blast2logo] is a tool for visualization of protein sequence profiles and identification of conserved residues. | <!-- * [https://services.healthtech.dtu.dk/service.php?Blast2logo Blast2logo] is a tool for visualization of protein sequence profiles and identification of conserved residues. | ||
--> | --> | ||
===Technical issues=== | |||
If you are denied access to the BLAST server, it may help to make a hotspot on your phone and use that to connect to the internet instead of the DTU Wi-Fi. | |||
In case you cannot make the BLAST server run at all, we have made some "backup output" links with copies of the relevant BLAST output page. '''Note:''' The backup outputs ''cannot'' show <u>Graphic Summary</u> or <u>Alignments</u>! | |||
==When BLAST fails== | ==When BLAST fails== | ||
Say you have a protein sequence [https://teaching.healthtech.dtu.dk/material/22111/files/Query1.txt Query] (also pasted below), and you want to | Say you have a protein sequence [https://teaching.healthtech.dtu.dk/material/22111/files/Query1.txt Query] (also pasted below), and you want to find a homologue with experimentally known structure. As seen earlier in the course, you will most often use BLAST to do this. However what happens when BLAST fails? | ||
>QUERY1 | >QUERY1 | ||
| Line 27: | Line 31: | ||
Go to the [http://www.ncbi.nlm.nih.gov/BLAST BLAST] web-site at NCBI. Select <u>blastp</u> as the algorithm. Paste in the query sequence. Change the database from | Go to the [http://www.ncbi.nlm.nih.gov/BLAST BLAST] web-site at NCBI. Select <u>blastp</u> as the algorithm. Paste in the query sequence. Change the database from <u>ClusteredNR</u> to <u>Protein Data Bank (pdb)</u>, and press <u>BLAST</u> (Figure 1). | ||
[[File:blastp_pdb.png|center|frame|Figure 1. Partial screenshot of the Blast interface. The red arrow shows the settings change to the database to pdb]] | [[File:blastp_pdb.png|center|frame|Figure 1. Partial screenshot of the Blast interface. The red arrow shows the settings change to the database to pdb]] | ||
| Line 33: | Line 37: | ||
* '''QUESTION 1''': How many significant hits does BLAST find (E-value < 0.005)? | * '''QUESTION 1''': How many significant hits does BLAST find (E-value < 0.005)? ([https://teaching.healthtech.dtu.dk/material/22111/PSI-BLAST/Q1.html backup output]) | ||
==Trying another approach== | ==Trying another approach== | ||
* '''QUESTION 2''': How many significant hits does BLAST find (E-value < 0.005)? ('''Tip:''' you can see the number by selecting all significant hits (clicking <u>All</u> under <u>Sequences | Now, <!-- go back to the search web-site of [https://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastp&PAGE_TYPE=BlastSearch&LINK_LOC=blasthome BLASTP].--> click on <u>Edit Search</u> on the results page (then you don't have to paste in the query sequence again). This time, set the database to <u>Reference proteins (refseq_protein)</u> and select <u>PSI-BLAST (Position-Specific Iterated BLAST)</u> as the algorithm (Figure 2). | ||
* '''QUESTION 3''': How large a fraction (Query coverage) of the query sequence do the significant hits match (excluding the | |||
* '''QUESTION 4''': Do you find any PDB hits among the significant hits? ('''Tip:''' look for a PDB identifier in the <u>Accession</u> column — a PDB identifier is a 4 character code, where the first character is a number, followed by a single letter chain name, such as "1XYZ_A") | '''IMPORTANT:''' To ease the load on the NCBI server, limit the search to Archaea (TaxID 2157) when searching Query1 in refseq_protein. We know that the mysterious "Query1" sequence is from an archaeon. | ||
[[File:psiblastp_nr.png|250px|center|frame|Figure 2. Partial screenshot of the PSI-BLAST interface. The red arrow shows the settings change to PSI-BLAST.]] | |||
* '''QUESTION 2''': How many significant hits does BLAST find (E-value < 0.005)? ('''Tip:''' you can see the number by selecting all significant hits (clicking <u>All</u> under <u>Sequences with E-value BETTER than threshold</u>) and then looking at the number of selected hits) ([https://teaching.healthtech.dtu.dk/material/22111/PSI-BLAST/Q2.html backup output]) | |||
* '''QUESTION 3''': How large a fraction (Query coverage) of the query sequence do the significant hits typically match (excluding the 100% identity match)? | |||
<!-- * '''QUESTION 4''': (deleted because it only makes sense when using nr) Do you find any PDB hits among the significant hits? ('''Tip:''' look for a PDB identifier in the <u>Accession</u> column — a PDB identifier is a 4 character code, where the first character is a number, followed by a single letter chain name, such as "1XYZ_A") --> | |||
===Constructing the PSSM=== | ===Constructing the PSSM=== | ||
| Line 48: | Line 56: | ||
:'''Note:''' If you see the error message “<u>Entrez Query: txid2157 [ORGN] is not supported</u>”, then click <u>Recent Results</u> in the upper right part of the BLAST window, select your most recent search, and try again. | :'''Note:''' If you see the error message “<u>Entrez Query: txid2157 [ORGN] is not supported</u>”, then click <u>Recent Results</u> in the upper right part of the BLAST window, select your most recent search, and try again. | ||
</div> | </div> | ||
Now run a second BLAST iteration in order to construct a PSSM (Position-Specific Scoring Matrix). Press the <u>Run</u> button at <u>Run PSI-Blast iteration 2</u> (you can find it at | Now run a second BLAST iteration in order to construct a PSSM (Position-Specific Scoring Matrix). Press the <u>Run</u> button at <u>Run PSI-Blast iteration 2</u> (you can find it both at the top of the results table and after the list of significant hits). | ||
* '''QUESTION | * '''QUESTION 4''': How many significant hits does BLAST find (E-value < 0.005)? ([https://teaching.healthtech.dtu.dk/material/22111/PSI-BLAST/Q4.html backup output]) | ||
* '''QUESTION 6''': How large a fraction of the query sequence do the 20 most significant hits match (do not include the | * '''QUESTION 5''': What is the E-value of the ''least'' significant hit shown on the results page? | ||
* '''QUESTION 6''': How large a fraction of the query sequence do the 20 most significant hits match (do not include the 100% identity match)? | |||
* '''QUESTION 7''': Why does BLAST come up with more significant hits in the second iteration? Make sure you answer this question and understand what is going on! | * '''QUESTION 7''': Why does BLAST come up with more significant hits in the second iteration? Make sure you answer this question and understand what is going on! | ||
===Saving and reusing the PSSM=== | ===Saving and reusing the PSSM=== | ||
This time, we will not ask you to look for PDB identifiers manually among the significant hits. Instead, you should save the PSSM that PSI-BLAST has created and use it for searching PDB directly. | <!-- This time, we will not ask you to look for PDB identifiers manually among the significant hits. Instead, you should save the PSSM that PSI-BLAST has created and use it for searching PDB directly.--> | ||
Now, you are going to save the PSSM that PSI-BLAST has created and use it for searching PDB. | |||
Go to the top of the PSI-BLAST output page and click <u>Download All</u>, then click <u>PSSM</u>. Save the file to a place on your computer where you can find it again! You can take a look at this file using Geany, but it is really not meant to be human-readable. | Go to the top of the PSI-BLAST output page and click <u>Download All</u>, then click <u>PSSM</u>. Save the file to a place on your computer where you can find it again! You can take a look at this file using Geany, but it is really not meant to be human-readable. ([https://teaching.healthtech.dtu.dk/material/22111/PSI-BLAST/Q4-PSSM_Scoremat.asn backup PSSM]) | ||
Then, open ''a new BLAST window'' (this is important—you need your first BLAST window again later) where you again select PSI-BLAST as the algorithm. Select <u>pdb</u> as the database. Do ''not'' limit your search to Archaea this time. Click on <u>Algorithm parameters</u> to show the extended settings. Click the button next to <u>Upload PSSM</u> and select the file you just saved. '''Note:''' You don't have to paste the query sequence again, it is stored in the PSSM! | Then, open ''a new BLAST window'' (this is important—you need your first BLAST window again later) where you again select PSI-BLAST as the algorithm. Select <u>pdb</u> as the database. Do ''not'' limit your search to Archaea this time. Click on <u>Algorithm parameters</u> to show the extended settings. Click the button next to <u>Upload PSSM</u> and select the file you just saved. '''Note:''' You don't have to paste the query sequence again, it is stored in the PSSM! | ||
* '''QUESTION 8''': Do you find any significant PDB hits now? If yes, how many? | * '''QUESTION 8''': Do you find any significant PDB hits (E-value < 0.005) now? If yes, how many? ([https://teaching.healthtech.dtu.dk/material/22111/PSI-BLAST/Q8.html backup output]) | ||
* '''QUESTION 9''': What are the PDB identifiers and the E-values for the two best PDB hits? | * '''QUESTION 9''': What are the PDB identifiers and the E-values for the two best PDB hits? | ||
* '''QUESTION 10''': What are the values for Query coverage, sequence identity, and sequence similarity (Positives) for the two best PDB hits? ('''Tip:''' click on the description to get to the actual alignment between the query sequence and the PDB hit)? | * '''QUESTION 10''': What are the values for Query coverage, sequence identity, and sequence similarity (Positives) for the two best PDB hits? ('''Tip:''' click on the description to get to the actual alignment between the query sequence and the PDB hit)? | ||
| Line 68: | Line 78: | ||
===One more round=== | ===One more round=== | ||
Let's try one more iteration of PSI-BLAST: | Let's try one more iteration of PSI-BLAST: | ||
* Go back to your first BLAST window (the one with the results from the <u> | * Go back to your first BLAST window (the one with the results from the <u>refseq_protein</u> database limited to Archaea) and press the <u>Run</u> button at <u>Run PSI-Blast iteration 3</u>. ([https://teaching.healthtech.dtu.dk/material/22111/PSI-BLAST/Q12A.html backup output]) | ||
* Save the resulting PSSM file (make sure you give it a different name!). | * Save the resulting PSSM file (make sure you give it a different name!). ([https://teaching.healthtech.dtu.dk/material/22111/PSI-BLAST/Q12-PSSM_Scoremat.asn backup PSSM]) | ||
* Launch a new PSI-BLAST search against <u>pdb</u> in all organisms using this PSSM (you may have to click on <u>Clear</u> to erase your first PSSM file from the server). | * Launch a new PSI-BLAST search against <u>pdb</u> in all organisms using this PSSM (you may have to click on <u>Clear</u> to erase your first PSSM file from the server). | ||
* '''QUESTION 12''': Answer questions 8-10 again for the new search. | * '''QUESTION 12''': Answer questions 8-10 again for the new search. ([https://teaching.healthtech.dtu.dk/material/22111/PSI-BLAST/Q12B.html backup output]) | ||
==Finding a remote homolog (on your own)== | ==Finding a remote homolog (on your own)== | ||
PSI-Blast is not only useful for finding a remote homolog in a specific database such as PDB — now it is time to search the broader database "Reference proteins" (<u>refseq_protein</u>). ('''Note:''' we would have liked to do this exercise in the broadest database <u>nr</u>, but that search runs into technical problems). PSI-BLAST can be used in the same way for finding a remote homolog in a specific organism or taxonomic group. Your task in this round is to find out whether the protein with the UniProt ID '''GPAA1_HUMAN''' has a homolog in the genus ''Trypanosoma'' (unicellular parasites which cause diseases like sleeping sickness or Chaga's disease). | PSI-Blast is not only useful for finding a remote homolog in a specific database such as PDB — now it is time to search the broader database "Reference proteins" (<u>refseq_protein</u>). ('''Note:''' we would have liked to do this exercise in the broadest database <u>nr</u>, but that search runs into technical problems). PSI-BLAST can be used in the same way for finding a remote homolog in a specific organism or taxonomic group. Your task in this round is to find out whether the protein with the UniProt ID '''GPAA1_HUMAN''' has a homolog in the genus ''Trypanosoma'' (unicellular parasites which cause diseases like sleeping sickness or Chaga's disease). | ||
* First, try a standard BlastP (where you set <u>Organism</u> to ''Trypanosoma'', <u>Database</u> to <u>refseq_protein</u> ('''not''' refseq_select), switch the <u>Low complexity regions</u> filter off, and set the E-value threshold to 10). | * First, try a standard BlastP (where you set <u>Organism</u> to ''Trypanosoma'', <u>Database</u> to <u>refseq_protein</u> ('''not''' refseq_select), switch the <u>Low complexity regions</u> filter off, and set the E-value threshold to 10). | ||
* '''QUESTION 13''': Do you find any significant (E<0.005) hits? What is the E-value of the best hit? | * '''QUESTION 13''': Do you find any significant (E<0.005) hits? What is the E-value of the best hit? ([https://teaching.healthtech.dtu.dk/material/22111/PSI-BLAST/Q13.html backup output]) | ||
* Then, try PSI-BLAST. '''Hint:''' You need to search in all organisms (still using refseq_protein) to build a PSSM, then save your PSSM and use that to search in ''Trypanosoma''. | * Then, try PSI-BLAST. '''Hint:''' You need to search in all organisms (still using refseq_protein) to build a PSSM, then save your PSSM and use that to search in ''Trypanosoma''. | ||
* '''QUESTION 14''': How many significant (E<0.005) hits do you find now? What is the E-value of the best hit? | * '''QUESTION 14''': How many significant (E<0.005) hits do you find now? What is the E-value of the best hit? ([https://teaching.healthtech.dtu.dk/material/22111/PSI-BLAST/Q14A.html backup output 1]) ([https://teaching.healthtech.dtu.dk/material/22111/PSI-BLAST/Q14-PSSM_Scoremat.asn backup PSSM]) ([https://teaching.healthtech.dtu.dk/material/22111/PSI-BLAST/Q14B.html backup output 2]) | ||
<!-- | <!-- | ||
Latest revision as of 15:11, 10 November 2025
Originally written by: Morten Nielsen — some editing by Rasmus Wernersson and Bent Petersen — new version by Henrik Nielsen.
Introduction
Earlier in the course you have used the BLAST program to perform fast alignments of DNA and protein sequences. As shown in today's lecture, BLAST will often fail to recognize relationships between proteins with low sequence similarity. In today's exercise, you will use the iterative BLAST program (PSI-BLAST) to calculate sequence profiles and see how such profiles can be used to identify relationships between proteins with low sequence similarity.
Links
- NCBI BLAST: http://www.ncbi.nlm.nih.gov/BLAST/
Technical issues
If you are denied access to the BLAST server, it may help to make a hotspot on your phone and use that to connect to the internet instead of the DTU Wi-Fi.
In case you cannot make the BLAST server run at all, we have made some "backup output" links with copies of the relevant BLAST output page. Note: The backup outputs cannot show Graphic Summary or Alignments!
When BLAST fails
Say you have a protein sequence Query (also pasted below), and you want to find a homologue with experimentally known structure. As seen earlier in the course, you will most often use BLAST to do this. However what happens when BLAST fails?
>QUERY1 MKDTDLSTLLSIIRLTELKESKRNALLSLIFQLSVAYFIALVIVSRFVRYVNYITYNNLV EFIIVLSLIMLIIVTDIFIKKYISKFSNILLETLNLKINSDNNFRREIINASKNHNDKNK LYDLINKTFEKDNIEIKQLGLFIISSVINNFAYIILLSIGFILLNEVYSNLFSSRYTTIS IFTLIVSYMLFIRNKIISSEEEEQIEYEKVATSYISSLINRILNTKFTENTTTIGQDKQL YDSFKTPKIQYGAKVPVKLEEIKEVAKNIEHIPSKAYFVLLAESGLRPGELLNVSIENID LKARIIWINKETQTKRAYFSFFSRKTAEFLEKVYLPAREEFIRANEKNIAKLAAANENQE IDLEKWKAKLFPYKDDVLRRKIYEAMDRALGKRFELYALRRHFATYMQLKKVPPLAINIL QGRVGPNEFRILKENYTVFTIEDLRKLYDEAGLVVLE
Go to the BLAST web-site at NCBI. Select blastp as the algorithm. Paste in the query sequence. Change the database from ClusteredNR to Protein Data Bank (pdb), and press BLAST (Figure 1).

- QUESTION 1: How many significant hits does BLAST find (E-value < 0.005)? (backup output)
Trying another approach
Now, click on Edit Search on the results page (then you don't have to paste in the query sequence again). This time, set the database to Reference proteins (refseq_protein) and select PSI-BLAST (Position-Specific Iterated BLAST) as the algorithm (Figure 2).
IMPORTANT: To ease the load on the NCBI server, limit the search to Archaea (TaxID 2157) when searching Query1 in refseq_protein. We know that the mysterious "Query1" sequence is from an archaeon.

- QUESTION 2: How many significant hits does BLAST find (E-value < 0.005)? (Tip: you can see the number by selecting all significant hits (clicking All under Sequences with E-value BETTER than threshold) and then looking at the number of selected hits) (backup output)
- QUESTION 3: How large a fraction (Query coverage) of the query sequence do the significant hits typically match (excluding the 100% identity match)?
Constructing the PSSM
- Note: If you see the error message “Entrez Query: txid2157 [ORGN] is not supported”, then click Recent Results in the upper right part of the BLAST window, select your most recent search, and try again.
Now run a second BLAST iteration in order to construct a PSSM (Position-Specific Scoring Matrix). Press the Run button at Run PSI-Blast iteration 2 (you can find it both at the top of the results table and after the list of significant hits).
- QUESTION 4: How many significant hits does BLAST find (E-value < 0.005)? (backup output)
- QUESTION 5: What is the E-value of the least significant hit shown on the results page?
- QUESTION 6: How large a fraction of the query sequence do the 20 most significant hits match (do not include the 100% identity match)?
- QUESTION 7: Why does BLAST come up with more significant hits in the second iteration? Make sure you answer this question and understand what is going on!
Saving and reusing the PSSM
Now, you are going to save the PSSM that PSI-BLAST has created and use it for searching PDB.
Go to the top of the PSI-BLAST output page and click Download All, then click PSSM. Save the file to a place on your computer where you can find it again! You can take a look at this file using Geany, but it is really not meant to be human-readable. (backup PSSM)
Then, open a new BLAST window (this is important—you need your first BLAST window again later) where you again select PSI-BLAST as the algorithm. Select pdb as the database. Do not limit your search to Archaea this time. Click on Algorithm parameters to show the extended settings. Click the button next to Upload PSSM and select the file you just saved. Note: You don't have to paste the query sequence again, it is stored in the PSSM!
- QUESTION 8: Do you find any significant PDB hits (E-value < 0.005) now? If yes, how many? (backup output)
- QUESTION 9: What are the PDB identifiers and the E-values for the two best PDB hits?
- QUESTION 10: What are the values for Query coverage, sequence identity, and sequence similarity (Positives) for the two best PDB hits? (Tip: click on the description to get to the actual alignment between the query sequence and the PDB hit)?
- QUESTION 11: What is the function of these proteins?
One more round
Let's try one more iteration of PSI-BLAST:
- Go back to your first BLAST window (the one with the results from the refseq_protein database limited to Archaea) and press the Run button at Run PSI-Blast iteration 3. (backup output)
- Save the resulting PSSM file (make sure you give it a different name!). (backup PSSM)
- Launch a new PSI-BLAST search against pdb in all organisms using this PSSM (you may have to click on Clear to erase your first PSSM file from the server).
- QUESTION 12: Answer questions 8-10 again for the new search. (backup output)
Finding a remote homolog (on your own)
PSI-Blast is not only useful for finding a remote homolog in a specific database such as PDB — now it is time to search the broader database "Reference proteins" (refseq_protein). (Note: we would have liked to do this exercise in the broadest database nr, but that search runs into technical problems). PSI-BLAST can be used in the same way for finding a remote homolog in a specific organism or taxonomic group. Your task in this round is to find out whether the protein with the UniProt ID GPAA1_HUMAN has a homolog in the genus Trypanosoma (unicellular parasites which cause diseases like sleeping sickness or Chaga's disease).
- First, try a standard BlastP (where you set Organism to Trypanosoma, Database to refseq_protein (not refseq_select), switch the Low complexity regions filter off, and set the E-value threshold to 10).
- QUESTION 13: Do you find any significant (E<0.005) hits? What is the E-value of the best hit? (backup output)
- Then, try PSI-BLAST. Hint: You need to search in all organisms (still using refseq_protein) to build a PSSM, then save your PSSM and use that to search in Trypanosoma.
- QUESTION 14: How many significant (E<0.005) hits do you find now? What is the E-value of the best hit? (backup output 1) (backup PSSM) (backup output 2)
Concluding remarks
Now you have seen the power of sequence profiles in general and the PSI-BLAST program in particular. Using sequence profiles you have been able to identify a relationship between protein sequences far below 30% sequence similarity. Further, you have made qualified predictions on the protein function and selected a set of essential amino acids suitable for experimental validation of the structural and functional predictions.