ExPairwiseAlignment: Difference between revisions
| (8 intermediate revisions by the same user not shown) | |||
| Line 41: | Line 41: | ||
Go back to https://teaching.healthtech.dtu.dk/alignment/ and open the "'''Pairwise Sequence Alignment Tool'''". This tool does not display the alignment matrix, but it can work with long sequences and allows for affine gap penalties (different values for gap opening and gap elongation). | Go back to https://teaching.healthtech.dtu.dk/alignment/ and open the "'''Pairwise Sequence Alignment Tool'''". This tool does not display the alignment matrix, but it can work with long sequences and allows for affine gap penalties (different values for gap opening and gap elongation). | ||
'''Note:''' Previously, we used the alignment webpage at EBI: https://www.ebi.ac.uk/jdispatcher/psa (you are welcome to try if you want), but that is a server-based application which becomes slow when 150+ students connect at the same time. The new local solution, which was vibe-coded in 2025 by a bachelor student as part of a special course, works much faster since all calculations are carried out on your own computers via JavaScript. | <div style="background-color: lavender; border: solid thin grey;"> | ||
:'''Note:''' Previously, we used the alignment webpage at EBI: https://www.ebi.ac.uk/jdispatcher/psa (you are welcome to try if you want), but that is a server-based application which becomes slow when 150+ students connect at the same time. The new local solution, which was vibe-coded in 2025 by a bachelor student as part of a special course, works much faster since all calculations are carried out on your own computers via JavaScript. | |||
</div> | |||
<!-- | <!-- | ||
[[File:PairwiseAlignment.png|thumb|210px|right|The different options at EBI (local and global alignment)]] | [[File:PairwiseAlignment.png|thumb|210px|right|The different options at EBI (local and global alignment)]] | ||
| Line 79: | Line 82: | ||
=== Global alignment === | === Global alignment === | ||
Your first task is to make a '''global alignment'''. | Your first task is to make a '''global alignment'''. | ||
* | * Choose <u>Protein Sequences</u> and <u>Global (Needleman-Wunsch)</u> at the top of the page. Paste in the sequences (it doesn't matter whether you include the header line) one sequence in each search box. | ||
* | * Below the sequence boxes you find the alignment options. Ensure that <u>Matrix</u> is set to "BLOSUM62" | ||
* Also | * Also, tick the box <U>Apply end gap penalties</u> (otherwise, the algorithm ignores gaps at the very ends of the alignment, ''i.e.'' gaps positioned at the end of one of the sequences would not cost anything). | ||
* Finally, perform the alignment by clicking the appropriate button and scroll down to see the result. | |||
* Finally, | |||
Have a look at the result. Notice that the degree of similarity between aligned amino acids is indicated with the following symbols: "<tt>|</tt>" indicates a perfect match, "<tt>:</tt>" indicates a "close" mismatch (positive value on the BLOSUM matrix, also known as a ''conservative substitution'' — the amino acids share some physico-chemical properties), and "<tt>.</tt>" indicates a "far" mismatch (zero or negative value on the BLOSUM matrix). | |||
[[Image:Office-notes-line_drawing.png|30px|left]] | [[Image:Office-notes-line_drawing.png|30px|left]] | ||
:'''QUESTION 2''': | :'''QUESTION 2.1''': | ||
: Report the following values / observations from the alignment. | :Report the following values / observations from the alignment. | ||
:* Alignment score | :* Alignment score | ||
:* Alignment length | :* Alignment length | ||
:* % and fraction Identity (The value reported for "Identity" includes perfect matches only) | :* % and fraction Identity (The value reported for "Identity" includes perfect matches only) | ||
:* % and fraction Similarity (The value reported for "Similarity" includes perfect matches + "close" mismatches) | :* % and fraction Similarity (The value reported for "Similarity" includes perfect matches + "close" mismatches) | ||
[[Image:Office-notes-line_drawing.png|30px|left]] | |||
:'''QUESTION 2.2''': | |||
:Now, perform the same alignment without applying gap penalties. Which values changed? | |||
=== Local Alignment === | === Local Alignment === | ||
Now, perform the alignment once again (preferably in a new browser tab/window, so it's easy to compare), but this time | Now, perform the alignment once again (preferably in a new browser tab/window, so it's easy to compare), but this time choose the <u>Local (Smith-Waterman)</u> algorithm. | ||
[[Image:Office-notes-line_drawing.png|30px|left]] | [[Image:Office-notes-line_drawing.png|30px|left]] | ||
| Line 144: | Line 149: | ||
[[Image:Office-notes-line_drawing.png|30px|left]] | [[Image:Office-notes-line_drawing.png|30px|left]] | ||
:'''QUESTION 6''': | :'''QUESTION 6''': | ||
: Compare Savinase to the human peptidase by global alignment | : Compare Savinase to the human peptidase by global alignment — remember again to tick <u>Apply end gap penalties</u> — and report the following: | ||
:* Alignment score | :* Alignment score | ||
:* Alignment length | :* Alignment length | ||
| Line 153: | Line 158: | ||
[[Image:Office-notes-line_drawing.png|30px|left]] | [[Image:Office-notes-line_drawing.png|30px|left]] | ||
:'''QUESTION 7''': | :'''QUESTION 7''': | ||
:Repeat the alignment with <u> | :Repeat the alignment with <u>Apply end gap penalties</u> unticked and report the same results as above. Does the alignment look different this time? | ||
[[Image:Office-notes-line_drawing.png|30px|left]] | [[Image:Office-notes-line_drawing.png|30px|left]] | ||
:'''QUESTION 8''': | :'''QUESTION 8''': | ||
:Repeat the alignment again — this time using the local alignment algorithm | :Repeat the alignment again — this time using the local alignment algorithm — and report the same results as above. | ||
[[Image:Office-notes-line_drawing.png|30px|left]] | [[Image:Office-notes-line_drawing.png|30px|left]] | ||
:'''QUESTION 9''': | :'''QUESTION 9''': | ||
:Do you think local or global alignment is best for finding | :Do you think local or global alignment is best for finding similarities in distantly related proteins? Why? | ||
:*Hint: Distantly related proteins typically share a core, that relates to the function of the protein | :*Hint: Distantly related proteins typically share a core, that relates to the function of the protein | ||
| Line 170: | Line 175: | ||
:'''When is an alignment "true"?''' | :'''When is an alignment "true"?''' | ||
:When we perform an alignment of two (or more) sequences, it's actually '''a statement of evolutionary relationship''': We | :When we perform an alignment of two (or more) sequences, it's actually '''a statement of evolutionary relationship''': We hypothesize that the sequences share a '''common ancestor''' - and that the sequences thus have diverged from an identical gene/protein throughout the eons. | ||
:The problem that we face right now in this part of the exercise, is that we're actually '''NOT sure''' if the two peptidases are related at all. As we discussed in the lecture, it's often possible to get at least some kind of alignment from unrelated sequences, but then the alignment score will be low. But in order to investigate if the alignment score we got from the alignment above indicates that the alignment is trustworthy, we need to get an idea of what '''range of alignment scores''' we can expect by aligning '''truly unrelated sequences'''. | :The problem that we face right now in this part of the exercise, is that we're actually '''NOT sure''' if the two peptidases are related at all. As we discussed in the lecture, it's often possible to get at least some kind of alignment from unrelated sequences, but then the alignment score will be low. But in order to investigate if the alignment score we got from the alignment above indicates that the alignment is trustworthy, we need to get an idea of what '''range of alignment scores''' we can expect by aligning '''truly unrelated sequences'''. | ||
| Line 180: | Line 185: | ||
* Open the <!-- SeqShuffle Server (http://www.cbs.dtu.dk/biotools/SeqShuffle-1.0/) --> "Shuffle Protein" page (http://www.bioinformatics.org/sms2/shuffle_protein.html) in a new window/tab, paste in the tripeptidyl peptidase sequence and shuffle it. | * Open the <!-- SeqShuffle Server (http://www.cbs.dtu.dk/biotools/SeqShuffle-1.0/) --> "Shuffle Protein" page (http://www.bioinformatics.org/sms2/shuffle_protein.html) in a new window/tab, paste in the tripeptidyl peptidase sequence and shuffle it. | ||
* Then align Savinase and the shuffled tripeptidyl peptidase sequence using local alignment. | * Then align Savinase and the shuffled tripeptidyl peptidase sequence using local alignment. | ||
* Repeat the above procedure | * Repeat the above procedure four more times, so that you align Savinase with ''five different'' shuffled versions of tripeptidyl peptidase. | ||
| Line 199: | Line 204: | ||
First, let's see how the alignment depends on the choice of substitution matrix. | First, let's see how the alignment depends on the choice of substitution matrix. | ||
* | * Again, use local protein alignment. | ||
* Choose the substitution matrix "BLOSUM90" instead of the default (BLOSUM62) | * Choose the substitution matrix "BLOSUM90" instead of the default (BLOSUM62) | ||
* Align Savinase and Tripeptidyl Peptidase | * Align Savinase and Tripeptidyl Peptidase (NOT shuffled) | ||
* Redo the alignment, this time with the matrix "BLOSUM30" | * Redo the alignment once again, this time with the matrix "BLOSUM30" | ||
You can see the three BLOSUM matrices on this page: [[BLOSUM matrix examples]] | |||
[[Image:Office-notes-line_drawing.png|30px|left]] | [[Image:Office-notes-line_drawing.png|30px|left]] | ||
:'''QUESTION 12''': | :'''QUESTION 12''': | ||
:* What are the alignment results (Length, score, gaps, identity, similarity)? | :* What are the alignment results (Length, score, gaps, identity, similarity)? | ||
:* How do alignment length and % identity depend on the BLOSUM number (compare also to your answer to question 8)? | :* How do alignment length and % identity depend on the BLOSUM number (compare also to your answer to question 8, using BLOSUM62)? | ||
=== Release the Gaps! === | === Release the Gaps! === | ||
As the last part of the comparison of sequences — let's allow as many gaps as possible, by making it almost "free" for the algorithm to insert gaps. | As the last part of the comparison of sequences — let's allow as many gaps as possible, by making it almost "free" for the algorithm to insert gaps. | ||
* | * Still, use local protein alignment. | ||
* Set the matrix back to "BLOSUM62" | * Set the matrix back to "BLOSUM62" | ||
* Set the Gap opening penalty to 1.0 | * Set the Gap opening penalty to 1.0 | ||
* Set the Gap extend penalty to 0. | * Set the Gap extend penalty to 0.01 | ||
* Align Savinase and Tripeptidyl Peptidase | * Align Savinase and Tripeptidyl Peptidase | ||
| Line 227: | Line 229: | ||
:'''QUESTION 13''': | :'''QUESTION 13''': | ||
:* How do the quality parameters look this time (Length, score, gaps, identity, similarity)? | :* How do the quality parameters look this time (Length, score, gaps, identity, similarity)? | ||
:* Is this | :* Look at the alignment. Is this biologically meaningful at all? | ||
==Epilogue — mostly for fun== | ==Epilogue — mostly for fun== | ||
[[Image:Cogs_brain.png|50px|right]] | [[Image:Cogs_brain.png|50px|right]] | ||
Go to UniProt and find the sequences with the IDs GLBE_CHITH and GLB7A_CHITH. These are two globins from a midge, a very small and annoying insect. If you have ever been to Scotland in the summer, you will know about midges. Make a global alignment of GLBE_CHITH and GLB7A_CHITH. | Go to UniProt and find the sequences with the IDs GLBE_CHITH and GLB7A_CHITH. These are two globins from a midge, a very small and annoying insect. If you have ever been to Scotland in the summer, you will know about midges. Make a global alignment of GLBE_CHITH and GLB7A_CHITH. '''Note:''' remember to set the gap penalties back to their default values: 10 for opening and 0.5 for elongation. | ||
[[Image:Office-notes-line_drawing.png|30px|left]] | [[Image:Office-notes-line_drawing.png|30px|left]] | ||
:'''QUESTION 14''': | :'''QUESTION 14''': | ||
Note that there is a gap of 6 positions in GLBE_CHITH. What is the corresponding 6 amino acid long sequence of GLB7A_CHITH? This is an authentic example! Nature truly is fascinating... | Note that there is a gap of 6 positions in GLBE_CHITH. What is the corresponding 6 amino acid long sequence of GLB7A_CHITH? This is an authentic example! Nature truly is fascinating... | ||
Latest revision as of 16:19, 10 September 2026
Exercise written by: Rasmus Wernersson, with modifications by Anne Bresciani, Ulrich Johan Kudahl, Anders Gorm Pedersen and Henrik Nielsen.
Introduction
In this exercise we will be working with pairwise alignment of protein sequences. As explained in today's lecture, pairwise alignment is performed using an algorithm known as Dynamic Programming (DP). In this exercise we will not go into further details about the mathematics behind the algorithm, but rather focus on the practical use of Pairwise Alignment, and how to critically evaluate the result.
Keep the following in mind as we go through the exercise (as mentioned in the lecture):
- The quality of an alignment is assessed through its alignment score.
- The alignment score is calculated based on match/mismatch of the amino acids via look-ups in a substitution matrix (for example BLOSUM62). The penalty for introducing gaps in the alignment is governed by two parameters: Gap opening ("expensive" - big penalty, e.g. 10 points) and Gap elongation ("cheap", e.g. 1 point).
- The BLOSUM substitution matrices are based on empirical data: substitutions that are seen frequently in real proteins have a higher score. We don't cover DNA matrices in this exercise.
- There are two main variants of the DP algorithm:
- Global alignment (Needleman-Wunsch) — the sequences are forced to be aligned across their entire length.
- Local alignment (Smith-Waterman) — only the best matching sub-part of the sequences are aligned).
Part 0 — interactive demos
Go to this website: https://teaching.healthtech.dtu.dk/alignment/. In the top part, "Interactive alignment demo with different algorithms", you will find four links to interactive JavaScript-based pages where you can insert two short sequences and get a display of the entire alignment matrix. You should play around with all four.
Start with "Needleman-Wunsch for simple scoring functions" and note how the entire alignment matrix changes interactively if you introduce mutations in the two sequences or change the values of the three scores. Note also that you can "mouse over" any cell in the matrix and see how its score is calculated.
Note: In these demos, there is only one gap penalty; in other words, there is no difference between gap opening and gap extension. When implementing such a difference, it becomes necessary to keep track of three alignment matrices, so the visualization is not so straightforward. The purpose of these pages is to demonstrate the general features of the algorithms rather than to provide an alignment tool.

- QUESTION 0.1:
Try replacing the two sequences with the sequences we used in the example in the lecture (slides 36-43). Does the website give you the same alignment matrix? Insert a screenshot of the resulting alignment matrix in your answer.
Then try "Smith-Waterman for simple scoring functions" and "Smith-Waterman with substitution matrices".

- QUESTION 0.2:
In "Smith-Waterman with substitution matrices", try replacing the two amino acid sequences with the sequences we used in the Smith-Waterman example in the lecture (slide 46). Does the website give you the same alignment matrix? Insert a screenshot of the resulting alignment matrix in your answer.
Part 1 — basic use
Go back to https://teaching.healthtech.dtu.dk/alignment/ and open the "Pairwise Sequence Alignment Tool". This tool does not display the alignment matrix, but it can work with long sequences and allows for affine gap penalties (different values for gap opening and gap elongation).
- Note: Previously, we used the alignment webpage at EBI: https://www.ebi.ac.uk/jdispatcher/psa (you are welcome to try if you want), but that is a server-based application which becomes slow when 150+ students connect at the same time. The new local solution, which was vibe-coded in 2025 by a bachelor student as part of a special course, works much faster since all calculations are carried out on your own computers via JavaScript.
For starters we will work with a pair of prokaryotic serine-proteases (both retrieved from UniProt). The first one (P29600) is the thermostable protease that the company Novozymes (now Novonesis) sells to the washing-powder industry under the trade-name "Savinase". The other sequence is likewise a thermostable serine-protease, but from a different species of bacteria.
>P29600|SUBS_LEDLE Subtilisin Savinase - Lederbergia lentus AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGN GHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVA NLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNR ASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQI RNHLKNTATSLGSTNLYGSGLVNAEAATR >P41363|ELYA_ALKHC Thermostable alkaline protease precursor - Alkalihalobacillus halodurans MRQSLKVMVLSTVALLFMANPAAASEEKKEYLIVVEPEEVSAQSVEESYDVDVIHEFEEI PVIHAELTKKELKKLKKDPNVKAIEKNAEVTISQTVPWGISFINTQQAHNRGIFGNGARV AVLDTGIASHPDLRIAGGASFISSEPSYHDNNGHGTHVAGTIAALNNSIGVLGVAPSADL YAVKVLDRNGSGSLASVAQGIEWAINNNMHIINMSLGSTSGSSTLELAVNRANNAGILLV GAAGNTGRQGVNYPARYSGVMAVAAVDQNGQRASFSTYGPEIEISAPGVNVNSTYTGNRY VSLSGTSMATPHVAGVAALVKSRYPSYTNNQIRQRINQTATYLGSPSLYGNGLVHAGRAT Q

- QUESTION 1:
- Which sequence format are the two sequences listed in?
Global alignment
Your first task is to make a global alignment.
- Choose Protein Sequences and Global (Needleman-Wunsch) at the top of the page. Paste in the sequences (it doesn't matter whether you include the header line) one sequence in each search box.
- Below the sequence boxes you find the alignment options. Ensure that Matrix is set to "BLOSUM62"
- Also, tick the box Apply end gap penalties (otherwise, the algorithm ignores gaps at the very ends of the alignment, i.e. gaps positioned at the end of one of the sequences would not cost anything).
- Finally, perform the alignment by clicking the appropriate button and scroll down to see the result.
Have a look at the result. Notice that the degree of similarity between aligned amino acids is indicated with the following symbols: "|" indicates a perfect match, ":" indicates a "close" mismatch (positive value on the BLOSUM matrix, also known as a conservative substitution — the amino acids share some physico-chemical properties), and "." indicates a "far" mismatch (zero or negative value on the BLOSUM matrix).

- QUESTION 2.1:
- Report the following values / observations from the alignment.
- Alignment score
- Alignment length
- % and fraction Identity (The value reported for "Identity" includes perfect matches only)
- % and fraction Similarity (The value reported for "Similarity" includes perfect matches + "close" mismatches)

- QUESTION 2.2:
- Now, perform the same alignment without applying gap penalties. Which values changed?
Local Alignment
Now, perform the alignment once again (preferably in a new browser tab/window, so it's easy to compare), but this time choose the Local (Smith-Waterman) algorithm.

- QUESTION 3:
- Report the same values as above (Alignment score etc). Consider the alignments produced by the two different approaches: do YOU think one of them is more biologically relevant than the other, or do both contribute valuable information?

QUESTION 4:
- Let's go a bit deeper into why the two sequences differ in the N-terminal part: Look up both entries in UniProt (http://www.uniprot.org) and try to locate information regarding the following questions.
- How were the amino acid sequences of the two proteins determined? (Hint: look at the titles of the papers, and the Cited for fields, listed under Publications).
- Subcellular localization: Where in (or outside) the cell do the enzymes function?
- The feature table contains details about the regions/domains of the protein - try to do a comparison to spot the differences between the two UniProt entries (Hint: focus on the "PTM / processing" section).

- QUESTION 5:
- Based on what you've learned about the P41363 protein from the alignment to Savinase and from the data on the Uniprot site: do you think this could be used as an enzyme in washing powder? (Why? / why not?).
Part 2 — about gaps and dubious alignments
So far we have been comparing sequences that are relatively closely related. It's now the time to compare our prokaryotic Savinase (P29600) protease with a human peptidase (a Tripeptidyl Peptidase), and see if they are related at all.
>sp|P29144|TPP2_HUMAN Tripeptidyl-peptidase 2 MATAATEEPFPFHGLLPKKETGAASFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDG KPKIVDIIDTTGSGDVNTATEVEPKDGEIVGLSGRVLKIPASWTNPSGKYHIGIKNGYDF YPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANNGSSQANKLIKEELQSQVEL LNSFEKKYSDPGPVYDCLVWHDGEVWRACIDSNEDGDLSKSTVLRNYKEAQEYGSFGTAE MLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTR LSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVINEAVWKHNIIYVSSA GNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSLREKLPANQYTWSSRGPSADGAL GVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALILSGLKANNIDYTVHSVRR ALENTAVKADNIEVFAQGHGIIQVDKAYDYLVQNTSFANKLGFTVTVGNNRGIYLRDPVQ VAAPSDHGVGIEPVFPENTENSEKISLQLHLALTSNSSWVQCPSHLELMNQCRHINIRVD PRGLREGLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVNESSHYDLAFTDVHFKPGQIR RHFIEVPEGATWAEVTVCSCSSEVSAKFVLHAVQLVKQRAYRSHEFYKFCSLPEKGTLTE AFPVLGGKAIEFCIARWWASLSDVNIDYTISFHGIVCTAPQLNIHASEGINRFDVQSSLK YEDLAPCITLKNWVQTLRPVSAKTKPLGSRDVLPNNRQLYEMVLTYNFHQPKSGEVTPSC PLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYPHQYSLKLEKGDYTIRLQIRHEQISDL ERLKDLPFIVSHRLSNTLSLDIHENHSFALLGKKKSSNLTLPPKYNQPFFVTSLPDDKIP KGAGPGCYLAGSLTLSKTELGKKADVIPVHYYLIPPPTKTKNGSKDKEKDSEKEKDLKEE FTEALRDLKIQWMTKLDSSDIYNELKETYPNYLPLYVARLHQLDAEKERMKRLNEIVDAA NAVISHIDQTALAVYIAMKTDPRPDAATIKNDMDKQKSTLVDALCRKGCALADHLLHTQA QDGAISTDAEGKEEEGESPLDSLAETFWETTKWTDLFDNKVLTFAYKHALVNKMYGRGLK FATKLVEEKPTKENWKNCIQLMKLLGWTHCASFTENWLPIMYPPDYCVF

- QUESTION 6:
- Compare Savinase to the human peptidase by global alignment — remember again to tick Apply end gap penalties — and report the following:
- Alignment score
- Alignment length
- Identity and Similarity
- How large a part of the alignment is gaps?

- QUESTION 7:
- Repeat the alignment with Apply end gap penalties unticked and report the same results as above. Does the alignment look different this time?

- QUESTION 8:
- Repeat the alignment again — this time using the local alignment algorithm — and report the same results as above.

- QUESTION 9:
- Do you think local or global alignment is best for finding similarities in distantly related proteins? Why?
- Hint: Distantly related proteins typically share a core, that relates to the function of the protein
- When is an alignment "true"?
- When we perform an alignment of two (or more) sequences, it's actually a statement of evolutionary relationship: We hypothesize that the sequences share a common ancestor - and that the sequences thus have diverged from an identical gene/protein throughout the eons.
- The problem that we face right now in this part of the exercise, is that we're actually NOT sure if the two peptidases are related at all. As we discussed in the lecture, it's often possible to get at least some kind of alignment from unrelated sequences, but then the alignment score will be low. But in order to investigate if the alignment score we got from the alignment above indicates that the alignment is trustworthy, we need to get an idea of what range of alignment scores we can expect by aligning truly unrelated sequences.
- It's difficult to find a sequence we can be 100% sure to be unrelated, and even if we did, the differences we might observe in alignment score could be due to differences in length and amino acid composition of the sequences. Instead, we can simply apply a small trick: if we shuffle one of the sequences (i.e. the amino acids are reordered randomly) prior to the alignment, any signature of its evolutionary relationships will be erased, and it will appear unrelated to any protein (while still having the same length and amino acid composition).
- Open the "Shuffle Protein" page (http://www.bioinformatics.org/sms2/shuffle_protein.html) in a new window/tab, paste in the tripeptidyl peptidase sequence and shuffle it.
- Then align Savinase and the shuffled tripeptidyl peptidase sequence using local alignment.
- Repeat the above procedure four more times, so that you align Savinase with five different shuffled versions of tripeptidyl peptidase.

- QUESTION 10:
- How do the local alignments look? (What are the ranges of Alignment score, Alignment length, Identity, Similarity, and gap percentage)?

- QUESTION 11:
- Comparing the Savinase/shuffled alignment to the previous Savinase/Human Peptidase alignment - how will you judge the alignment with human peptidase now? (More/Less confidence in relation between the sequences?).
Part 3 — about parameters

The third part of the exercise is meant to illustrate that alignments is dependent on parameters. We can make anything look like similar sequences, if we twist the parameters enough.
Choose the Matrix
First, let's see how the alignment depends on the choice of substitution matrix.
- Again, use local protein alignment.
- Choose the substitution matrix "BLOSUM90" instead of the default (BLOSUM62)
- Align Savinase and Tripeptidyl Peptidase (NOT shuffled)
- Redo the alignment once again, this time with the matrix "BLOSUM30"
You can see the three BLOSUM matrices on this page: BLOSUM matrix examples

- QUESTION 12:
- What are the alignment results (Length, score, gaps, identity, similarity)?
- How do alignment length and % identity depend on the BLOSUM number (compare also to your answer to question 8, using BLOSUM62)?
Release the Gaps!
As the last part of the comparison of sequences — let's allow as many gaps as possible, by making it almost "free" for the algorithm to insert gaps.
- Still, use local protein alignment.
- Set the matrix back to "BLOSUM62"
- Set the Gap opening penalty to 1.0
- Set the Gap extend penalty to 0.01
- Align Savinase and Tripeptidyl Peptidase

- QUESTION 13:
- How do the quality parameters look this time (Length, score, gaps, identity, similarity)?
- Look at the alignment. Is this biologically meaningful at all?
Epilogue — mostly for fun

Go to UniProt and find the sequences with the IDs GLBE_CHITH and GLB7A_CHITH. These are two globins from a midge, a very small and annoying insect. If you have ever been to Scotland in the summer, you will know about midges. Make a global alignment of GLBE_CHITH and GLB7A_CHITH. Note: remember to set the gap penalties back to their default values: 10 for opening and 0.5 for elongation.

- QUESTION 14:
Note that there is a gap of 6 positions in GLBE_CHITH. What is the corresponding 6 amino acid long sequence of GLB7A_CHITH? This is an authentic example! Nature truly is fascinating...