ExBlast-Answers new

From 22111
Revision as of 18:23, 21 September 2026 by Carol (talk | contribs) (→‎QUESTION 2.1)
Jump to navigation Jump to search

Answers to the BLAST exercise. Values for database sizes etc. retrieved September 21, 2026


Part 1: Your first BLAST search

QUESTION 1.1

The main difference is that core_nt excludes most eukaryotic chromosome sequences, making it smaller and faster than nr/nt, so NCBI uses it as the default for more efficient searches.

QUESTION 1.2

  • Which database did you use?
core_nt
  • what is the identifier (Accession)?
J00336.1 (Note that the latter was also part of the sequence name for your query sequence!)
  • what is the alignment score ("Max score in bits")?
The max score is 708 bits
  • what is the percent identity and query coverage?
100% and 100%
  • what is the E-value?
0.0 (actually, a number so small that it is rounded off to 0.0)
  • are there any gaps in the alignment?
No, of course not, since the sequences are identical

QUESTION 1.3

  • Which database did you use?
core_nt
  • what is the identifier (Accession)?
NM_000207.3
  • what is the alignment score ("max score")?
603
  • what is the percent identity and query coverage?
identity: 94.34% and query coverage: 99%
  • what is the E-value?
7e-168 (meaning 7×10-168)
  • are there any gaps in the alignment?
No

QUESTION 1.4

  • Which database did you use?
Human G+T (2 databases)
  • what is the identifier (Accession)?
NM_000207.3, they have the same score and are therefore equally good. Note that these are among the equally good hits found in the previous question.
  • what is the alignment score ("max score")?
603
  • what is the percent identity and query coverage?
identity: 94.34% and query coverage: 99%
  • what is the E-value?
3e-170 (meaning 3×10-170)
  • are there any gaps in the alignment?
No

QUESTION 1.5

What are the sizes (in basepairs) of the databases we used for the two BLAST searches?

nt(Human): 1,081,933,534,067 letters (= basepairs), Human G+T: 4,017,001,775 letters (= basepairs).

QUESTION 1.6

  • What is the ratio between the database sizes in the two BLAST searches?
1,081,933,534,067 / 4,017,001,775 = ~269
  • What is the ratio between the E-values (for the best human hits) in the two BLAST searches?
7e-168 / 3e-170 = ~233
Note: since the E-values have only three significant digits, you cannot expect to get the exact same result.
Also note, you can google "7e-168 / 3e-170" directly and the answer will show up in the results.
  • What is the relationship between database size and E-value for hits with identical alignment score?
The E-value is directly proportional to the database size.
Note: Conceptually this means that an alignment within the given score (603 bits) is more SIGNIFICANT in the smaller database. In larger database there is a larger chance of randomly picking up matches.
  • In conclusion: if the database size is doubled, what will happen to the E-value?
Each time the database size doubles, the E-value doubles as well.

Part 2: Assessing the statistical significance of BLAST hits

QUESTION 2.1

****Alignment**** 1
Title: gi|2440392781|emb|OX421481.1| Eilema caniola genome assembly, chromosome: 20
Accession: OX421481
Length: 22119023
Max Score: 44.0
Bits: 40.9604
Identities: 22
Align_length: 22
Gaps: 0
%Ident: 100.00 %
Query Cover: 88 %
E value: 1.88e+00
TTCTGAAAGGTCCTCTCGATAC
||||||||||||||||||||||
TTCTGAAAGGTCCTCTCGATAC
  • What is the typical length of the hits (the alignment length)?:
Typically around 17-24 base pairs.
  • What is the typical % identity?:
90% - 100%
  • In what range are the bit-scores ("max score)?:
typically 30-40 bits.
  • What is the range of the E-values?:
1-15
usually varying from 1 to 50 (occasionally, you might find hits as "good" as 0.1).
Note: we chose to use an E-value threshold of 50.0. The default is 0.05.

QUESTION 2.2

What is the biological significance of the hits you found / is there any biological meaning?:

This makes absolutely NO biological sense(!) The hits are real enough as such, they represent sequences that actually are in the database. But we know that our query sequences are completely random and therefore have no evolutionary relationship with the hits. The only reason we found our hits is that the database is so vast that we for for purely stochastic reasons happen upon sequences that are similar.

The E-values tell us precisely this: As described in the BLAST lecture, the alignment score will follow an extreme value distribution for those sequences that are not related to our query sequences, and the E-value is the expected number of spurious (unrelated) hits with the given alignment score or better, given the database size.

Note: Don't be confused by the difference between alignment score and bit score; bit score is simply the alignment score normalized by a constant factor which gives a result expressible in bits.

QUESTION 2.3

  • What is the typical length of the alignment and do they contain gaps?:
Typically 15-22. Rarely gaps, but several mismatches.
  • What is the range of E-values?:
Typically 100-1000
  • Try to inspect a few of the alignments in details ("+" means similar) - do you find any that look plausible, if we for a moment ignore the length/E-value?
Yes, maybe. See e.g. the alignment below, it has 77% identities (but it is way too short to be significant, as the E-value tells us).
****Alignment**** 1
Title: ref|WP_179589105.1| non-ribosomal peptide synthetase [Pigmentiphaga litoralis] >gb|NYE25977.1| amino acid adenylation domain-containing protein [Pigmentiphaga litoralis] >gb|NYE85097.1| amino acid adenylation domain- containing protein [Pigmentiphaga litoralis]
Accession: WP_179589105
Length: 1782
Max Score: 67.0
Bits: 30.4166
Identities: 8
Align_length: 22
Gaps: 0
%Ident: 36.36 %
Query Cover: 88 %
E value: 1.25e+02
LTNNVNMHWTLPYTVSHVYVNP
L   ++ HW +P+T+SH++ +P
LAARISQHWCVPFTISHIFDHP


  • If we had used the default E-value cutoff of 10 would any hits have been found?:
No (note: the default is actually 0.05 now). Note the difference from the nucleotide database searches (whose E-values were typically in the range 1-50): if we had run BLASTN with an E-value threshold of 1000, we would have had many pages of hits for each query sequence.

QUESTION 2.4

  • If we compare the result from BLAST'ing random DNA sequences to random Peptide sequences - which kind of search has the higher risk of returning false positives (results that appear plausible, maybe even significant, but are truly unrelated)?:
The risk of getting a false hit (an unrelated sequence with a "decent" E-value) is much larger when working with DNA sequences. Remember than we used 50 as E-value cut-off for BLASTN, while we used 1000 with BLASTP in order to see any hits at all.

Part 3: using BLAST to transfer functional information by finding homologs

  • Do we find any significant hits? (E-value?):
Yes, a lot. The first many hits have an E-value of 0.0, and hit #100 is still very significant (3e-98) — note that by default, only the top 100 hits are shown!
  • Are all the best hits the same category of enzymes?:
Yes, they are alkaline proteases (except a few that are hypothetical proteins).
Note that you can click the Accession code for a hit and go directly to the corresponding entry in the database.
  • From what you have seen, what is best for identifying intermediate quality hits - DNA or Protein BLAST?:
Protein BLAST (BLASTP). If you have very high quality hits, they can be identified by both methods, but if the evolutionary distance is larger, BLASTP is clearly better.
Note: Recall from the PyMOL exercises that information between distant genes/proteins are conserved from: Structure > Peptide Sequence > Nucleotide sequence. So when the evolutionary distance is larger, blastp would generally give better hits than blastn.

-->

QUESTION 3.1

STEP 1 - cleaning up the sequence:

  • Subquestion: convert the sequence to FASTA format (manually, in Geany) and quote it in your report.
>CLONE12
AACGGGCACGGGACGCATGTAGCTGGAACAGTGGCAGCCGTAAATAATAATGGTATCGGA
GTTGCCGGGGTTGCAGGAGGAAACGGCTCTACCAATAGTGGAGCAAGGTTAATGTCCACA
CAAATTTTTAATAGTGATGGGGATTATACAAATAGCGAAACTCTTGTGTACAGAGCCATT
GTTTATGGTGCAGATAACGGAGCTGTGATCTCGCAAAATAGCTGGGGTAGTCAGTCTCTG
ACTATTAAGGAGTTGCAGAAAGCTGCGATCGACTATTTCATTGATTATGCAGGAATGGAC
GAAACAGGAGAAATACAGACAGGCCCTATGAGGGGAGGTATATTTATAGCTGCCGCCGGA
AACGATAACGTTTCCACTCCAAATATGCCTTCAGCTTATGAACGGGTTTTAGCTGTGGCC
TCAATGGGACCAGATTTTACTAAGGCAAGCTATAGCACTTTTGGAACATGGACTGATATT
ACTGCTCCTGGCGGAGATATTGACAAATTTGATTTGTCAGAATACGGAGTTCTCAGCACT
TATGCCGATAATTATTATGCTTATGGAGAGGGAACATCCATGGCTTGTCCACATGTCGCC
GGCGCCGCC

STEP 2 - thinking about the task:

  • Subquestion: Give a summary of your considerations.
    • Based on the information given: is the sequence protein-coding?
Yes — we know this because the PCR primers used to clone the sequence target known enzymes. Therefore, it will make sense to try to translate the sequence using Virtual Ribosome.
  • If it is, can you trust it will contain both a START and STOP codon?
No — the PCR primers used to clone the sequence target the middle of the sequence, in other words we must assume that our sequence is a fragment. Therefore, the ORF finder in Virtual Ribosome should be set to Start codon: None.
  • Do we know if the sequence is sense or anti-sense?
No — the PCR process amplifies a stretch of double-stranded DNA. Therefore, we should let Virtual Ribosome search in all 6 reading frames.

STEP 3 - Performing the database search: We want to use BLAST to search the large databases. Let's therefore try the following:

  1. BLASTN
  2. Translate to protein (using Virtual Ribosome).
  3. BLASTP

Both when doing BLASTN and BLASTP we will use the NR database in order to search as broadly as possible. It would not make sense to use an organism-specific database when we don't know which organism our sequence stems from.

1) BLASTN. When trying BLASTN against NR we get some borderline significant results, but observe how small the query coverage percentages are (check also the Graphic Summary tab!).

There is simply nothing in the entire NR database that has enough similarity to our whole query sequence. A search on the DNA level is only suited for finding very close hits.

2) Translate using Virtual Ribosome with the settings we chose under Step 2 above.

The result from the ORF finder:

VIRTUAL RIBOSOME
----------------
Translation table: Standard SGC0 

>CLONE12_rframe1_ORF
Reading frame: 1

    N  G  H  G  T  H  V  A  G  T  V  A  A  V  N  N  N  G  I  G  V  A  G  V  A  G  G  N  G  S  
5' AACGGGCACGGGACGCATGTAGCTGGAACAGTGGCAGCCGTAAATAATAATGGTATCGGAGTTGCCGGGGTTGCAGGAGGAAACGGCTCT 90
   .......................................................................................... 

    T  N  S  G  A  R  L  M  S  T  Q  I  F  N  S  D  G  D  Y  T  N  S  E  T  L  V  Y  R  A  I  
5' ACCAATAGTGGAGCAAGGTTAATGTCCACACAAATTTTTAATAGTGATGGGGATTATACAAATAGCGAAACTCTTGTGTACAGAGCCATT 180
   .....................>>>.................................................................. 

    V  Y  G  A  D  N  G  A  V  I  S  Q  N  S  W  G  S  Q  S  L  T  I  K  E  L  Q  K  A  A  I  
5' GTTTATGGTGCAGATAACGGAGCTGTGATCTCGCAAAATAGCTGGGGTAGTCAGTCTCTGACTATTAAGGAGTTGCAGAAAGCTGCGATC 270
   .........................................................)))............)))............... 

    D  Y  F  I  D  Y  A  G  M  D  E  T  G  E  I  Q  T  G  P  M  R  G  G  I  F  I  A  A  A  G  
5' GACTATTTCATTGATTATGCAGGAATGGACGAAACAGGAGAAATACAGACAGGCCCTATGAGGGGAGGTATATTTATAGCTGCCGCCGGA 360
   ........................>>>..............................>>>.............................. 

    N  D  N  V  S  T  P  N  M  P  S  A  Y  E  R  V  L  A  V  A  S  M  G  P  D  F  T  K  A  S  
5' AACGATAACGTTTCCACTCCAAATATGCCTTCAGCTTATGAACGGGTTTTAGCTGTGGCCTCAATGGGACCAGATTTTACTAAGGCAAGC 450
   ........................>>>....................................>>>........................ 

    Y  S  T  F  G  T  W  T  D  I  T  A  P  G  G  D  I  D  K  F  D  L  S  E  Y  G  V  L  S  T  
5' TATAGCACTTTTGGAACATGGACTGATATTACTGCTCCTGGCGGAGATATTGACAAATTTGATTTGTCAGAATACGGAGTTCTCAGCACT 540
   ...............................................................)))........................ 

    Y  A  D  N  Y  Y  A  Y  G  E  G  T  S  M  A  C  P  H  V  A  G  A  A  
5' TATGCCGATAATTATTATGCTTATGGAGAGGGAACATCCATGGCTTGTCCACATGTCGCCGGCGCCGCC 609
   .......................................>>>........................... 

(Tip: Remember that you can get the sequence in FASTA format via the FASTA link on the result page):

>CLONE12_rframe1_ORF
NGHGTHVAGTVAAVNNNGIGVAGVAGGNGSTNSGARLMSTQIFNSDGDYTNSETLVYRAI
VYGADNGAVISQNSWGSQSLTIKELQKAAIDYFIDYAGMDETGEIQTGPMRGGIFIAAAG
NDNVSTPNMPSAYERVLAVASMGPDFTKASYSTFGTWTDITAPGGDIDKFDLSEYGVLST
YADNYYAYGEGTSMACPHVAGAA

3) BLASTP


We get several very significant hits. When looking at the top hits and disregarding "hypothetical" and "uncharacterized" proteins, we can see that the rest are almost all serine proteases. Some of them are described as belonging to the of the S8 family.

Let's take a closer look at the first hit that is not "uncharacterized":

Note that although it is not a perfect hit (our query sequence not existing in the database) it looks reasonable: the alignment covers a large part of the query with Identity of 54% and Similarity (Positives) of 69%.

Taken together with the fact that almost all the best non-hypothetical hits are serine proteases, we have a very strong indication that our mystery sequence, CLONE12, is a peptidase or protease of the S8 family.

Part 4: BLAST'ing Genomes

QUESTION 4.1

What information is given about the relationship between this gene and the gene "HTA1"?

They are nearly identical ("one of two nearly identical (see also HTA1) subtypes").

Protein sequence:

>YBL003C  
MSGGKGGKAGSAAKASQSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYL
AAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPK
KSAKTAKASQEL*

QUESTION 4.2

  • How many high-confidence hits do we get?:
3 — HTA1, HTA2 and HTZ1.
Note: If you click on the Gene links for the two top hits, you will see that one is HTA1 and the other is HTA2.
  • Do the hits make sense, from what you have read about HTA2 at the SGD webpage?:
Yes; HTA1 and HTA2 are indeed nearly identical (only 2 amino acids differ).

QUESTION 4.3

  • How many high-confidence hits (with E-value better than 10-10) are found?
Answer: 29.